PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016508949.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 119aa    MW: 13084.9 Da    PI: 7.1896
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016508949.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.71.3e-122391148
                    HHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
          SRF-TF 11 vtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                    vtfskRr+g++KK   L  +++a+va i+fs+tgk y+
  XP_016508949.1  2 VTFSKRRKGLFKKTLQLESMTGARVAAIVFSPTGKPYT 39
                    9*********************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF003198.4E-16139IPR002100Transcription factor, MADS-box
PROSITE profilePS5006614.129144IPR002100Transcription factor, MADS-box
CDDcd001202.95E-14239No hitNo description
SMARTSM004322.3E-4243IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-12244IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-5621IPR002100Transcription factor, MADS-box
PRINTSPR004044.9E-52142IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MVTFSKRRKG LFKKTLQLES MTGARVAAIV FSPTGKPYTC GDVSSAIDRH FSSSIDPLSG  60
SGDVCISGSR STTSRNGLRN WLENIDVEEL LLLKEQLEGT REKLACMEDS ESFLALFMS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617106.13e-83PREDICTED: MADS-box transcription factor 23-like
TrEMBLM1C1S72e-42M1C1S7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000578554e-42(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23371757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17310.11e-12M-type_MADS family protein